PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa018329
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family ZF-HD
Protein Properties Length: 135aa    MW: 14404.1 Da    PI: 6.2652
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58658168PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer73.14.3e-2392135347
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACg 47 
                   vrY+eClkNhA+s+Gg a+DGCgEfmps geegt +al+C+AC+
    Lsa018329  92 MVRYRECLKNHAVSIGGIATDGCGEFMPS-GEEGTLEALTCSACN 135
                  79**************************9.999***********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.0E-2193135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-1593135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.8E-2294135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152322.4895135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MEHQGGEMAL PINSTYGGGH GHGHMLHHES APHNHIVPSS AAAVAVAQKQ HQHQLQLPIT  60
NGPTRIVPLP SCSSLEESVQ VPYTNNDDNR MMVRYRECLK NHAVSIGGIA TDGCGEFMPS  120
GEEGTLEALT CSACN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007023152.15e-31Homeobox protein 31
TrEMBLA0A103UI042e-46A0A103UI04_CYNCS; Homeodomain-like protein
STRINGPOPTR_0003s00800.13e-29(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-21homeobox protein 31